PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00042.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 341aa    MW: 38604.4 Da    PI: 5.4073
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00042.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-161562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W +eEd++l  ++++ G g W++I++  g++R++k+c++rw +yl
  Rsa1.0_00042.1_g00028.1 15 KGPWMPEEDDKLMAYIHKNGYGKWRSIPNLAGLNRCGKSCRLRWMNYL 62
                             79********************************************97 PP

2Myb_DNA-binding56.37.1e-1868113148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg +T +E+  +v+++++lG++ W++Ia++++ gRt++++k++w++++
  Rsa1.0_00042.1_g00028.1  68 RGEFTDDEESTIVKLHALLGNK-WSKIASHLP-GRTDNEIKNYWNTHM 113
                              899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-23765IPR009057Homeodomain-like
PROSITE profilePS5129418.9761062IPR017930Myb domain
SuperFamilySSF466895.31E-3012109IPR009057Homeodomain-like
SMARTSM007176.4E-111464IPR001005SANT/Myb domain
PfamPF002494.8E-151562IPR001005SANT/Myb domain
CDDcd001675.34E-91762No hitNo description
PROSITE profilePS5129426.67963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2766117IPR009057Homeodomain-like
SMARTSM007171.5E-1667115IPR001005SANT/Myb domain
PfamPF002495.7E-1668112IPR001005SANT/Myb domain
CDDcd001673.16E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRSPCCDQD KGVKKGPWMP EEDDKLMAYI HKNGYGKWRS IPNLAGLNRC GKSCRLRWMN  60
YLRPDIRRGE FTDDEESTIV KLHALLGNKW SKIASHLPGR TDNEIKNYWN THMRKKMLQM  120
GIDPITHEPR TNDLSNIRDV SQMLAAAIGN GQFGNNTFFN NNTAVEDLLK LQLIHKMLQI  180
ITPKTIPNIN SFNTNSLNTK PEPVVNNIKT NPVDPKPKLA AAGHLNAIEP HVFTNQTENE  240
DFMPSFEDVW DCTEDNQLPG LVMVSQENLN YYGDQLHEVP STGSMSVTPE ASGLNYPGMT  300
QQSSGSDVLE DWEKFLDDET TDSCWKSFLD LTSPTSSPYP W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26151174105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-261511727128MYB TRANSFORMING PROTEIN
1mse_C1e-26151174105C-Myb DNA-Binding Domain
1msf_C1e-26151174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136872.10.0PREDICTED: transcription factor MYB39
RefseqXP_013741326.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP00.0MYB39_ARATH; Transcription factor MYB39
TrEMBLM4D8310.0M4D831_BRARP; Uncharacterized protein
STRINGBra012641.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.10.0myb domain protein 39